Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311183

Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDG1K, HMAT1, HMT-1, HMT1, MT-1, Mat-1, hMat-1, zgc:66221, wu:fi34b12
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311183
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1
Sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDEL LQNNRIQIVG
Predicted Reactivity Human : 100%, Mouse : 84%, Rabbit : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against ALG1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALG1
Background ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process.
Molecular Weight 52kDa
Gene ID 56052
NCBI Accession NP_061982, NM_019109
UniProt Q9BT22
Research Area Cardiovascular, Fatty Acids, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALG1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grubenmann, Frank, Hülsmeier et al.: "Deficiency of the first mannosylation step in the N-glycosylation pathway causes congenital disorder of glycosylation type Ik." in: Human molecular genetics, Vol. 13, Issue 5, pp. 535-42, 2004 (PubMed).

Alternatives for antigen "Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1)", type "Antibodies"
Hosts (10), (2)
Reactivities (11), (2), (2)
Applications (12), (6), (4), (1), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon