Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) antibody

Details for Product No. ABIN311183
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CDG1K, HMAT1, HMT-1, HMT1, MT-1, Mat-1, hMat-1, zgc:66221, wu:fi34b12
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(13), (3), (3)
Host
Rabbit
(12), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (6), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311183
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALG1
Sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDEL LQNNRIQIVG
Predicted Reactivity Human : 100 %, Mouse : 80 %, Rabbit : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against ALG1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALG1
Background ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process.
Molecular Weight 52 kDa
Gene ID 56052
NCBI Accession NM_019109, NP_061982
UniProt Q9BT22
Research Area Cardiovascular, Fatty Acids, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 464 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) antibody WB Suggested Anti-ALG1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate
Background publications Grubenmann, Frank, Hülsmeier et al.: "Deficiency of the first mannosylation step in the N-glycosylation pathway causes congenital disorder of glycosylation type Ik." in: Human molecular genetics, Vol. 13, Issue 5, pp. 535-42, 2004 (PubMed).

Hosts (12), (2)
Reactivities (13), (3), (3)
Applications (14), (6), (5), (2), (1)
Epitopes (2), (2), (1), (1), (1)
back to top