Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311477

Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASRT7, CGP-39, GP-39, GP39, HC-gp39, HCGP-3P, YKL-40, YKL40, YYL-40, hCGP-39, Chil1, GP38K, CLP-1, SPC-40, SPS-40
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunofluorescence (IF)
Pubmed 1 reference available
Catalog no. ABIN311477
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1
Sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNT DYAVGYMLRL
Predicted Reactivity Human : 100%, Rabbit : 100%, Pig : 84%, Rat : 76%
Characteristics This is a rabbit polyclonal antibody against CHI3L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHI3L1
Background CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Molecular Weight 42kDa
Gene ID 1116
NCBI Accession NP_001267, NM_001276
UniProt P36222
Research Area Signaling, Extracellular Matrix, Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHI3L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ober, Tan, Sun et al.: "Effect of variation in CHI3L1 on serum YKL-40 level, risk of asthma, and lung function." in: The New England journal of medicine, Vol. 358, Issue 16, pp. 1682-91, 2008 (PubMed).

Alternatives for antigen "Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1)", type "Antibodies"
Hosts (25), (16)
Reactivities (33), (16), (16)
Applications (28), (18), (10), (8), (7), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (2), (1)
Beacon