Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311522

Dynein, Light Chain, LC8-Type 2 (DYNLL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DNCL1B, Dlc2, RSPH22, dynll2, wu:fd56c09, zgc:73406, 1700064A15Rik, 6720463E02Rik, C87222, DLC8, DLC8b, dlc2, dncl1b
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Caenorhabditis elegans (C. elegans), Fruit Fly (Drosophila melanogaster), Zebrafish (Danio rerio), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311522
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DYNLL2 antibody: synthetic peptide directed towards the N terminal of human DYNLL2
Sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAA YIKKEFDKKY
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 100%, Goat : 92%
Characteristics This is a rabbit polyclonal antibody against DYNLL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DYNLL2
Background DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
Molecular Weight 10kDa
Gene ID 140735
NCBI Accession NP_542408, NM_080677
UniProt Q96FJ2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DYNLL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pfister, Fisher, Gibbons et al.: "Cytoplasmic dynein nomenclature." in: The Journal of cell biology, Vol. 171, Issue 3, pp. 411-3, 2005 (PubMed).

Alternatives for antigen "Dynein, Light Chain, LC8-Type 2 (DYNLL2)", type "Antibodies"
Hosts (8), (2)
Reactivities (9), (6), (6)
Applications (9), (5), (4), (1)
Epitopes (2), (1), (1)
Beacon