DYNLL2 antibody (N-Term)

Catalog No. ABIN630885

Product Details anti-DYNLL2 Antibody

Target: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, C. elegans, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYNLL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DYNLL2 antibody was raised against the N terminal of DYNLL2

Purification: Affinity purified

Immunogen: DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYNLL2 Blocking Peptide, catalog no. 33R-6410, is also available for use as a blocking control in assays to test for specificity of this DYNLL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYNLL2

Target: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Alternative Name: DYNLL2 (DYNLL2 Products)

Synonyms: DNCL1B antibody, Dlc2 antibody, RSPH22 antibody, dlc2 antibody, dncl1b antibody, 1700064A15Rik antibody, 6720463E02Rik antibody, C87222 antibody, DLC8 antibody, DLC8b antibody, dynein light chain LC8-type 2 antibody, dynein light chain LC8-type 2 S homeolog antibody, DYNLL2 antibody, dynll2.S antibody, dynll2 antibody, Dynll2 antibody

Background: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

Molecular Weight: 10 kDa (MW of target protein)

Pathways: M Phase