Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405311

SIP1 (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405311
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1
Sequence HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYF DQRDLADEPS
Predicted Reactivity Bovine :100%,   Human :100%,   Mouse :92%,   Rat :92%,  
Characteristics This is a rabbit polyclonal antibody against SIP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
Molecular Weight 30kDa
Gene ID 8487
NCBI Accession NP_001009182, NM_001009182
UniProt O14893-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).

Alternatives for antigen "SIP1", type "Antibodies"
Hosts (26), (1)
Reactivities (25), (22), (20), (12), (12)
Applications (18), (14), (10), (7), (5), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (1), (1), (1)
Beacon