MIF4G Domain Containing (MIF4GD) (N-Term) antibody

Details for Product No. ABIN405365
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AD023, MIFD, SLIP1, 1110014L05Rik, 2310075G12Rik, RGD1309685, MIF4GD
Epitope
N-Term
(4), (3), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(10), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(9), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (3), (3), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405365
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MIF4GD
Sequence MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSV CQRSYSNCSR
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against MIF4GD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MIF4GD
Background MIF4GD is a protein which contains an MIF4G domain. This gene encodes a protein which contains an MIF4G domain.
Molecular Weight 29 kDa
Gene ID 57409
NCBI Accession NM_020679, NP_065730
UniProt A9UHW6-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 256 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Cakmakci, Lerner, Wagner et al.: "SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein." in: Molecular and cellular biology, Vol. 28, Issue 3, pp. 1182-94, 2008 (PubMed).

Hosts (9), (4)
Reactivities (10), (1), (1), (1), (1), (1), (1)
Applications (12), (3), (3), (3), (1), (1)
Epitopes (4), (3), (2), (1)
back to top