Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405365

MIF4G Domain Containing (MIF4GD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AD023, MIFD, SLIP1, 1110014L05Rik, 2310075G12Rik, RGD1309685, MIF4GD
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405365
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MIF4GD antibody: synthetic peptide directed towards the N terminal of human MIF4GD
Sequence MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSV CQRSYSNCSR
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against MIF4GD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MIF4GD
Background MIF4GD is a protein which contains an MIF4G domain. This gene encodes a protein which contains an MIF4G domain.
Molecular Weight 29kDa
Gene ID 57409
NCBI Accession NP_065730, NM_020679
UniProt A9UHW6-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MIF4GD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cakmakci, Lerner, Wagner et al.: "SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein." in: Molecular and cellular biology, Vol. 28, Issue 3, pp. 1182-94, 2008 (PubMed).

Alternatives for antigen "MIF4G Domain Containing (MIF4GD)", type "Antibodies"
Hosts (9), (4)
Reactivities (10), (1), (1), (1), (1), (1), (1)
Applications (12), (3), (3), (3), (1), (1)
Epitopes (4), (3), (2), (1)
Beacon