Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405874

Dullard Homolog (Xenopus Laevis) (DULLARD) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Dullard, 2610507E10Rik, DULLARD, HSA011916, NET56, dullard, im:7137489, wu:fi48e07, zgc:92207, ctdnep1, dullard-b, net56
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405874
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DULLARD antibody: synthetic peptide directed towards the middle region of human DULLARD
Sequence HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVL SRNLHQHRLW
Predicted Reactivity Zebrafish :100%,   Human :100%,   African clawed frog :100%,   Green puffer :100%,   Mouse :100%,   Rat :100%,   Western clawed frog :100%,   Bovine :100%,   Channel catfish :100%,   Dog :100%,   Blood fluke :100%,   Atlantic salmon :100%,   Trichoplax reptans :100%,   Harpegnathos saltator :92%,   Yellowfever mosquito :92%,   Silk moth :92%,   African malaria mosquito :92%,   Camponotus floridanus :92%,   Body louse :92%,   Red flour beetle :92%,   Pea aphid :92%,   Florida lancelet :92%,   Black-legged tick :92%,   Fruit fly :92%,   Acorn worm :92%,   Starlet sea anemone :90%,  
Characteristics This is a rabbit polyclonal antibody against DULLARD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DULLARD
Background DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
Molecular Weight 28kDa
Gene ID 23399
NCBI Accession NP_056158, NM_015343
UniProt O95476
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DULLARD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Gentry, Harris et al.: "A conserved phosphatase cascade that regulates nuclear membrane biogenesis." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 16, pp. 6596-601, 2007 (PubMed).

Alternatives for antigen "Dullard Homolog (Xenopus Laevis) (DULLARD)", type "Antibodies"
Hosts (21)
Reactivities (20), (12), (12), (12), (12)
Applications (12), (10), (9), (6), (5), (2)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon