Dullard Homolog (Xenopus Laevis) (DULLARD) (Middle Region) antibody

Details for Product No. ABIN405874
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Dullard, 2610507E10Rik, DULLARD, HSA011916, NET56, dullard, im:7137489, wu:fi48e07, zgc:92207, ctdnep1, dullard-b, net56
Epitope
Middle Region
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Dog (Canine), Human
(19), (12), (12), (12), (12)
Host
Rabbit
(20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (8), (5), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN405874
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DULLARD
Sequence HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVL SRNLHQHRLW
Predicted Reactivity Zebrafish :100 %,   Human :100 %,   African clawed frog :100 %,   Green puffer :100 %,   Mouse :100 %,   Rat :100 %,   Western clawed frog :100 %,   Bovine :100 %,   Channel catfish :100 %,   Dog :100 %,   Blood fluke :100 %,   Atlantic salmon :100 %,   Trichoplax reptans :100 %,   Harpegnathos saltator :90 %,   Yellowfever mosquito :90 %,   Silk moth :90 %,   African malaria mosquito :90 %,   Camponotus floridanus :90 %,   Body louse :90 %,   Red flour beetle :90 %,   Pea aphid :90 %,   Florida lancelet :90 %,   Black-legged tick :90 %,   Fruit fly :90 %,   Acorn worm :90 %,   Starlet sea anemone :90 %,  
Characteristics This is a rabbit polyclonal antibody against DULLARD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DULLARD
Background DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.
Molecular Weight 28 kDa
Gene ID 23399
NCBI Accession NM_015343, NP_056158
UniProt O95476
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 244 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Kim, Gentry, Harris et al.: "A conserved phosphatase cascade that regulates nuclear membrane biogenesis." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 16, pp. 6596-601, 2007 (PubMed).

Hosts (20)
Reactivities (19), (12), (12), (12), (12)
Applications (11), (10), (8), (5), (4), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top