CTDNEP1A antibody

Catalog No. ABIN634833

Product Details anti-CTDNEP1A Antibody

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTDNEP1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DULLARD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTDNEP1A

Target: CTDNEP1A (CTD Nuclear Envelope Phosphatase 1a (CTDNEP1A))

Alternative Name: DULLARD (CTDNEP1A Products)

Synonyms: Dullard antibody, 2610507E10Rik antibody, DULLARD antibody, HSA011916 antibody, NET56 antibody, dullard antibody, im:7137489 antibody, wu:fi48e07 antibody, zgc:92207 antibody, ctdnep1 antibody, dullard-b antibody, net56 antibody, CTD nuclear envelope phosphatase 1 antibody, CTD nuclear envelope phosphatase 1a antibody, CTD nuclear envelope phosphatase 1 L homeolog antibody, Ctdnep1 antibody, CTDNEP1 antibody, ctdnep1a antibody, ctdnep1.L antibody

Background: DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.

Molecular Weight: 28 kDa (MW of target protein)