Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405988

NudC Domain Containing 1 (NUDCD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cml66, CML66-L, AA407246, AW260430, AW556235, 4921532K09Rik, CML66, OVA66, RGD1310624, cml66, im:6901299, im:6912119, wu:fc11c02, zgc:110705
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN405988
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDCD1 antibody: synthetic peptide directed towards the N terminal of human NUDCD1
Sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAV AEVKLRDDQY
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against NUDCD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NUDCD1
Background NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.
Molecular Weight 67kDa
Gene ID 84955
NCBI Accession NP_116258, NM_032869
UniProt Q96RS6
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDCD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Zhu, Hart, Chang et al.: "Analysis of the major patterns of B cell gene expression changes in response to short-term stimulation with 33 single ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 173, Issue 12, pp. 7141-9, 2004 (PubMed).

Background publications Yan, Phan, Yang et al.: "A novel mechanism of alternative promoter and splicing regulates the epitope generation of tumor antigen CML66-L." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 172, Issue 1, pp. 651-60, 2003 (PubMed).

Alternatives for antigen "NudC Domain Containing 1 (NUDCD1)", type "Antibodies"
Hosts (9)
Reactivities (8), (1), (1), (1), (1), (1), (1)
Applications (9), (2), (2)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Beacon