Did you know that you can buy products from over 140 different suppliers from us?

NudC Domain Containing 1 (NUDCD1) (N-Term) antibody

Details for Product No. ABIN405988
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cml66, CML66-L, AA407246, AW260430, AW556235, 4921532K09Rik, CML66, OVA66, RGD1310624, cml66, im:6901299, im:6912119, wu:fc11c02, zgc:110705
Epitope
N-Term
(8), (6), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(12)
Host
Rabbit
(13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (7), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405988
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NUDCD1
Sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAV AEVKLRDDQY
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against NUDCD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NUDCD1
Background NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.
Molecular Weight 67 kDa
Gene ID 84955
NCBI Accession NM_032869, NP_116258
UniProt Q96RS6
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 583 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Zhu, Hart, Chang et al.: "Analysis of the major patterns of B cell gene expression changes in response to short-term stimulation with 33 single ligands." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 173, Issue 12, pp. 7141-9, 2004 (PubMed).

Background publications Yan, Phan, Yang et al.: "A novel mechanism of alternative promoter and splicing regulates the epitope generation of tumor antigen CML66-L." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 172, Issue 1, pp. 651-60, 2003 (PubMed).

Hosts (13)
Reactivities (12)
Applications (13), (7), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405988
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top