Did you know that you can buy products from over 140 different suppliers from us?

Glutaminyl-Peptide Cyclotransferase (QPCT) (Middle Region) antibody

Details for Product No. ABIN406016
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms QPCT, GCT, QC, sQC, 5730422A13Rik
Epitope
Middle Region
(8), (7), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Dog (Canine), Human, Chicken
(22)
Host
Rabbit
(17), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (13), (3), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406016
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human QPCT
Sequence SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNP TFPNFFPNSA
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Bovine : 80 %, Pig : 80 %, Sheep : 80 %, Dog : 70 %, Horse : 70 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against QPCT. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name QPCT
Background QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. QPCT may be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86 % identical to that of bovine glutaminyl cyclase.
Molecular Weight 38 kDa
Gene ID 25797
NCBI Accession NM_012413, NP_036545
UniProt Q16769
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 361 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Cynis, Rahfeld, Stephan et al.: "Isolation of an isoenzyme of human glutaminyl cyclase: retention in the Golgi complex suggests involvement in the protein maturation machinery." in: Journal of molecular biology, Vol. 379, Issue 5, pp. 966-80, 2008 (PubMed).

Validation Images
back to top