Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406066

Family with Sequence Similarity 38, Member B (FAM38B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5930434P17, 9030411M15Rik, 9430028L06Rik, Fam38b, Fam38b2, RGD1306866, C18orf30, C18orf58, FAM38B, FAM38B2, HsT748, HsT771
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406066
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM38B antibody: synthetic peptide directed towards the middle region of human FAM38B
Sequence AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN NFMDITIILS
Specificity Specific to isoforms 1, 2, 3 and 4.
Predicted Reactivity Mouse : 100%
Characteristics This is a rabbit polyclonal antibody against FAM38B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM38B
Background FAM38B is a multi-pass membrane proteinPotential. It belongs to the FAM38 family.The exact function of FAM38B remains unknown.
Molecular Weight 81kDa
Gene ID 63895
NCBI Accession NP_071351, NM_022068
UniProt Q9H5I5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM38B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 38, Member B (FAM38B)", type "Antibodies"
Hosts (7)
Reactivities (6), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (7), (2)
Epitopes (3), (3), (2), (1), (1)
Beacon