Family with Sequence Similarity 38, Member B (FAM38B) (Middle Region) antibody

Details for Product No. ABIN406066
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5930434P17, 9030411M15Rik, 9430028L06Rik, Fam38b, Fam38b2, RGD1306866, C18orf30, C18orf58, FAM38B, FAM38B2, HsT748, HsT771
Epitope
Middle Region
(3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(7)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406066
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAM38B
Sequence AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN NFMDITIILS
Specificity Specific to isoforms 1, 2, 3 and 4.
Predicted Reactivity Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against FAM38B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM38B
Background FAM38B is a multi-pass membrane proteinPotential. It belongs to the FAM38 family.The exact function of FAM38B remains unknown.
Molecular Weight 81 kDa
Gene ID 63895
NCBI Accession NM_022068, NP_071351
UniProt Q9H5I5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 709 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 38, Member B (FAM38B) (Middle Region) antibody WB Suggested Anti-FAM38B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (7), (1)
Reactivities (7)
Applications (8), (1), (1)
Epitopes (3), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top