Did you know that you can buy products from over 140 different suppliers from us?

Stratifin (SFN) (Middle Region) antibody

Details for Product No. ABIN406432
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms YWHAS, Er, Mme1, Ywhas
Epitope
Middle Region
(18), (14), (10), (9), (8), (7), (7), (5), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Dog (Canine), Human
(118), (35), (29), (16), (13), (6), (4), (3), (2), (1), (1), (1)
Host
Rabbit
(86), (30), (6), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (5), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB), Immunohistochemistry (IHC)
(111), (49), (40), (38), (15), (15), (15), (10), (9), (4), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406432
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SFN
Sequence FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTL IMQLLRDNLT
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against SFN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SFN
Background SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
Molecular Weight 28 kDa
Gene ID 2810
NCBI Accession NM_006142, NP_006133
UniProt P31947
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 248 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Stratifin (SFN) (Middle Region) antibody WB Suggested Anti-SFN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
anti-Stratifin (SFN) (Middle Region) antibody (2) anti-Stratifin (SFN) (Middle Region) antibody (Image 2)
Product cited in: Lu, Zhu, Wen et al.: "Nicotinamide N-methyl transferase (NNMT) gene polymorphisms and risk for spina bifida." in: Birth defects research. Part A, Clinical and molecular teratology, Vol. 82, Issue 10, pp. 670-5, 2008 (PubMed).

Background publications Yang, Dicker, Chen et al.: "CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2." in: Cell cycle (Georgetown, Tex.), Vol. 7, Issue 5, pp. 670-82, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406432
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top