Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406432

Stratifin (SFN) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms YWHAS, Er, Mme1, Ywhas
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN406432
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN
Sequence FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTL IMQLLRDNLT
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against SFN. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SFN
Background SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
Molecular Weight 28kDa
Gene ID 2810
NCBI Accession NP_006133, NM_006142
UniProt P31947
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lu, Zhu, Wen et al.: "Nicotinamide N-methyl transferase (NNMT) gene polymorphisms and risk for spina bifida." in: Birth defects research. Part A, Clinical and molecular teratology, Vol. 82, Issue 10, pp. 670-5, 2008 (PubMed).

Background publications Yang, Dicker, Chen et al.: "CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2." in: Cell cycle (Georgetown, Tex.), Vol. 7, Issue 5, pp. 670-82, 2008 (PubMed).

Alternatives for antigen "Stratifin (SFN)", type "Antibodies"
Hosts (67), (25), (7), (2)
Reactivities (95), (32), (28), (16), (13), (6), (4), (3), (2), (1), (1), (1)
Applications (88), (38), (35), (26), (14), (14), (10), (9), (3), (2), (1), (1)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (9), (8), (8), (5), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon