Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406694

ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8orf2, Erlin-2, NET32, SPFH2, SPG18, BC036333, C87251, Spfh2, RGD1309010
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Fruit Fly (Drosophila melanogaster), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406694
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2
Sequence ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLED EPLETATKEN
Predicted Reactivity Human : 100%, Rabbit : 100%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against ERLIN2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ERLIN2
Background ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Molecular Weight 38kDa
Gene ID 11160
NCBI Accession NP_009106, NM_007175
UniProt O94905
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ERLIN2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pearce, Wang, Kelley et al.: "SPFH2 mediates the endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors and other substrates in mammalian cells." in: The Journal of biological chemistry, Vol. 282, Issue 28, pp. 20104-15, 2007 (PubMed).

Alternatives for antigen "ER Lipid Raft Associated 2 (ERLIN2)", type "Antibodies"
Hosts (23), (6)
Reactivities (26), (16), (14), (12), (12), (12), (12), (1), (1), (1), (1), (1), (1)
Applications (19), (10), (10), (5), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1), (1), (1), (1), (1)
Beacon