Did you know that you can buy products from over 140 different suppliers from us?

ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) antibody

Details for Product No. ABIN406694
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8orf2, Erlin-2, NET32, SPFH2, SPG18, BC036333, C87251, Spfh2, RGD1309010
Epitope
Middle Region
(9), (7), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Fruit Fly (Drosophila melanogaster), Pig (Porcine), Human
(31), (15), (14), (12), (12), (12), (12)
Host
Rabbit
(27), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (14), (10), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406694
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ERLIN2
Sequence ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLED EPLETATKEN
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against ERLIN2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ERLIN2
Background ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Molecular Weight 38 kDa
Gene ID 11160
NCBI Accession NM_007175, NP_009106
UniProt O94905
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 339 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) antibody WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
anti-ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) antibody (2) anti-ER Lipid Raft Associated 2 (ERLIN2) (Middle Region) antibody (Image 2)
Background publications Pearce, Wang, Kelley et al.: "SPFH2 mediates the endoplasmic reticulum-associated degradation of inositol 1,4,5-trisphosphate receptors and other substrates in mammalian cells." in: The Journal of biological chemistry, Vol. 282, Issue 28, pp. 20104-15, 2007 (PubMed).

Hosts (27), (5)
Reactivities (31), (15), (14), (12), (12), (12), (12)
Applications (22), (14), (10), (5), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406694
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top