POU Class 3 Homeobox 3 (POU3F3) (N-Term) antibody

Details for Product No. ABIN487007
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Brn-1, Brn1, Otf8, Skin1, BRN1, OTF8, RHS1
Epitope
N-Term
(2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(23), (16), (15), (12), (12), (12), (12), (1)
Host
Rabbit
(20), (2), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (10), (8), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN487007
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human POU3F3
Sequence GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQ SDFMQGAMAA
Predicted Reactivity Mouse :100 %,   Rat :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against POU3F3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name POU3F3
Background POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction, the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1, MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].
Molecular Weight 50 kDa
Gene ID 5455
NCBI Accession NM_006236, NP_006227
UniProt P20264
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 500 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-POU Class 3 Homeobox 3 (POU3F3) (N-Term) antibody WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Wissmüller, Kosian, Wolf et al.: "The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors." in: Nucleic acids research, Vol. 34, Issue 6, pp. 1735-44, 2006 (PubMed).

Hosts (20), (2), (2)
Reactivities (23), (16), (15), (12), (12), (12), (12), (1)
Applications (15), (10), (8), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1), (1)
back to top