Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487007

POU Class 3 Homeobox 3 (POU3F3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Brn-1, Brn1, Otf8, Skin1, BRN1, OTF8, RHS1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487007
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-POU3F3 antibody: synthetic peptide directed towards the N terminal of human POU3F3
Sequence GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQ SDFMQGAMAA
Predicted Reactivity Mouse :100%,   Rat :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against POU3F3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name POU3F3
Background POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction, the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1, MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].
Molecular Weight 50kDa
Gene ID 5455
NCBI Accession NP_006227, NM_006236
UniProt P20264
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-POU3F3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissmüller, Kosian, Wolf et al.: "The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors." in: Nucleic acids research, Vol. 34, Issue 6, pp. 1735-44, 2006 (PubMed).

Alternatives for antigen "POU Class 3 Homeobox 3 (POU3F3)", type "Antibodies"
Hosts (8), (2), (1)
Reactivities (10), (4), (3), (1)
Applications (11), (5), (2)
Epitopes (3), (2), (2), (1), (1), (1), (1), (1)
Beacon