Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487212

Forkhead Box N4 (FOXN4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms whn, whna
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487212
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXN4 antibody: synthetic peptide directed towards the middle region of human FOXN4
Sequence QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASG GSDQSFPDLQ
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Pig : 92%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against FOXN4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FOXN4
Background Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops
Molecular Weight 36kDa
Gene ID 121643
NCBI Accession NP_998761, NM_213596
UniProt Q96NZ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXN4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Alternatives for antigen "Forkhead Box N4 (FOXN4)", type "Antibodies"
Hosts (19)
Reactivities (19), (1), (1), (1), (1), (1)
Applications (19), (10), (1)
Epitopes (6), (5), (3), (1), (1), (1)
Beacon