Did you know that you can buy products from over 140 different suppliers from us?

Forkhead Box N4 (FOXN4) (Middle Region) antibody

Details for Product No. ABIN487212
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms whn, whna
Epitope
Middle Region
(15), (9), (7), (7), (1), (1), (1), (1)
Reactivity
Human
(34), (1), (1), (1), (1), (1)
Host
Rabbit
(34)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(34), (23), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487212
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FOXN4
Sequence QGNLWEEMKDEGFSLDTLGAFADSPLGCDLGASGLTPASG GSDQSFPDLQ
Predicted Reactivity Dog : 100 %, Human : 100 %, Bovine : 90 %, Pig : 90 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against FOXN4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FOXN4
Background Members of the winged-helix/forkhead family of transcription factors, such as FOXN4, are characterized by a 110-amino acid DNA-binding domain that can fold into a variant of the helix-turn-helix motif consisting of 3 alpha helices flanked by 2 large loops
Molecular Weight 36 kDa
Gene ID 121643
NCBI Accession NM_213596, NP_998761
UniProt Q96NZ1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 337 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box N4 (FOXN4) (Middle Region) antibody WB Suggested Anti-FOXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Validation Images
back to top