• Homepage
  • Antibodies
  • anti-UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Ter...

UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Term) antibody

Details for Product No. ABIN487236
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
EDSP2, SEMDJL1, beta3GalT6, BB129894, GalTII, B3GALT6, MGC69183, Dyak\\GE22868, GE22868, beta3galt6, dyak_GLEANR_663, Dere\\GG10628, GG10628, dere_GLEANR_10535, Dper\\GL21178, GL21178, dper_GLEANR_310 ... show more
EDSP2, SEMDJL1, beta3GalT6, BB129894, GalTII, B3GALT6, MGC69183, Dyak\\GE22868, GE22868, beta3galt6, dyak_GLEANR_663, Dere\\GG10628, GG10628, dere_GLEANR_10535, Dper\\GL21178, GL21178, dper_GLEANR_3106, Dsec\\GM20673, GM20673, dsec_GLEANR_3487, Dpse\\GA28758, GA28758, dpse_GLEANR_8882 show less
Epitope
C-Term
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(11), (4), (4), (1), (1), (1)
Host
Rabbit
(10), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN487236
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human B3GALT6
Sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATL AREGRLCKRE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against B3GALT6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name B3GALT6
Background B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
Molecular Weight 37 kDa
Gene ID 126792
NCBI Accession NM_080605, NP_542172
UniProt Q96L58
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 329 AA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Term) antibody WB Suggested Anti-B3GALT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (10), (3)
Reactivities (11), (4), (4), (1), (1), (1)
Applications (13), (4), (2), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top