Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)

UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
beta3GalT6, BB129894, GalTII, B3GALT6, MGC69183, dyak_GLEANR_663, DyakGE22868, GE22868, beta3galt6, dere_GLEANR_10535, DereGG10628, GG10628, dper_GLEANR_3106, DperGL21178, GL21178, dsec_GLEANR_3487, D ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487236
Quantity 50 µg
Price
317.90 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Term) antibody

Product details

Target Details Application Details Handling Images References Alternatives back to top
Immunogen The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the C terminal of human B3GALT6
Sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATL AREGRLCKRE
Predicted Reactivity 156565
Characteristics This is a rabbit polyclonal antibody against B3GALT6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified

Target Details

Application Details Handling Images References Alternatives back to top
Alternative Name B3GALT6
Background B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
Molecular Weight 37kDa
Gene ID 126792
NCBI Accession NP_542172, NM_080605
UniProt Q96L58

Application Details

Target Details Handling Images References Alternatives back to top
Restrictions For Research Use only

Handling

Target Details Application Details Images References Alternatives back to top
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-B3GALT6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20°C.

References

Target Details Application Details Handling Images Alternatives back to top
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives

Target Details Application Details Handling Images References back to top
Alternatives for antigen "UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6)", type "Antibodies"
Hosts (9)
Reactivities (7), (1), (1), (1), (1), (1)
Applications (9), (4), (2), (1)
Epitopes (2), (2), (1)
Beacon
Guglhupf
Guglhupf Guglhupf Guglhupf