Search, Find and Buy Antibodies, ELISA Kits and Proteins.

UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) (C-Term) antibody

Details for Product No. ABIN487236

	Want additional data for this product? The Independent Validation Initiative strives to provide you with high quality data. Find out more
Antigen
Synonyms	EDSP2, SEMDJL1, beta3GalT6, BB129894, GalTII, B3GALT6, MGC69183, Dyak\\GE22868, GE22868, beta3galt6, dyak_GLEANR_663, Dere\\GG10628, GG10628, dere_GLEANR_10535, Dper\\GL21178, GL21178, dper_GLEANR_310 ... show more EDSP2, SEMDJL1, beta3GalT6, BB129894, GalTII, B3GALT6, MGC69183, Dyak\\GE22868, GE22868, beta3galt6, dyak_GLEANR_663, Dere\\GG10628, GG10628, dere_GLEANR_10535, Dper\\GL21178, GL21178, dper_GLEANR_3106, Dsec\\GM20673, GM20673, dsec_GLEANR_3487, Dpse\\GA28758, GA28758, dpse_GLEANR_8882 show less
Epitope	Alternatives C-Term (2), (2), (2), (1), (1)
Reactivity	Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken (11), (4), (4), (1), (1), (1)
Host	Alternatives Rabbit (10), (3)
Clonality	Polyclonal
Application	Alternatives Western Blotting (WB) (13), (4), (2), (1), (1), (1)
	1 reference available
Catalog no.	ABIN487236
Quantity	50 µg
Price	289.00 $ Plus shipping costs $45.00
Options
Shipping to	United States (Change)
Availability	Will be delivered in 2 to 3 Business Days

Purchasing Process

Order hotline:

+1 404 474 4654
+1 888 205 9894 (TF)

Product details Alternatives References Images Handling Application Details Target details back to top		Product details Show Hide
Immunogen	Synthetic peptide directed towards the C terminal of human B3GALT6
Sequence	VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATL AREGRLCKRE
Predicted Reactivity	Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics	This is a rabbit polyclonal antibody against B3GALT6. It was validated on Western Blot using a cell lysate as a positive control.
Purification	Affinity Purified

Target details Alternatives References Images Handling Application Details back to top		Target details Show Hide
Alternative Name	B3GALT6
Background	B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.
Molecular Weight	37 kDa
Gene ID	126792
NCBI Accession	NM_080605, NP_542172
UniProt	Q96L58

Application Details Alternatives References Images Handling Target details back to top		Application Details Show Hide
Application Notes	Optimal working dilutions should be determined experimentally by the investigator.
Comment	Antigen size: 329 AA
Restrictions	For Research Use only

Handling Alternatives References Images Application Details Target details back to top		Handling Show Hide
Format	Lyophilized
Reconstitution	Add 50 µL of distilled water.
Concentration	1 mg/mL
Buffer	PBS buffer with 2 % sucrose
Handling Advice	Avoid repeated freeze-thaw cycles.
Storage	-20 °C
Storage Comment	For longer periods of storage, store at -20 °C

Images Alternatives References Handling Application Details Target details back to top		Images Show Hide
Supplier Images	WB Suggested Anti-B3GALT6 Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain

References Alternatives Images Handling Application Details Target details back to top		References Show Hide
Background publications	Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives References Images Handling Application Details Target details back to top		Alternatives Show Hide
Hosts	(10), (3)
Reactivities	(11), (4), (4), (1), (1), (1)
Applications	(13), (4), (2), (1), (1), (1)
Epitopes	(2), (2), (2), (1), (1)