Did you know that you can buy products from over 140 different suppliers from us?

Chromodomain Helicase DNA Binding Protein 4 (CHD4) (N-Term) antibody

Details for Product No. ABIN501272
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mi-2b, Mi2-BETA, 9530019N15Rik, AA617397, BC005710, D6Ertd380e, Mi-2beta, mKIAA4075, Mi-2, b230399n07, CHD4, im:7143343, si:ch211-51m24.3, si:ch211-57k11.10, wu:fb44b12, wu:fd12d03, MGC145363
Epitope
N-Term
(3), (2), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(34), (11), (3)
Host
Rabbit
(25), (11)
Clonality
Polyclonal
Application
Western Blotting (WB)
(25), (20), (12), (10), (9), (6), (4), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501272
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CHD4
Sequence QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDY TPGKKKKKKL
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CHD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CHD4
Background CHD4 is a probable transcription regulator.The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein.
Molecular Weight 218 kDa
Gene ID 1108
NCBI Accession NM_001273, NP_001264
UniProt Q14839
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1912 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromodomain Helicase DNA Binding Protein 4 (CHD4) (N-Term) antibody WB Suggested Anti-CHD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate
Background publications Sillibourne, Delaval, Redick et al.: "Chromatin remodeling proteins interact with pericentrin to regulate centrosome integrity." in: Molecular biology of the cell, Vol. 18, Issue 9, pp. 3667-80, 2007 (PubMed).

Hosts (25), (11)
Reactivities (34), (11), (3)
Applications (25), (20), (12), (10), (9), (6), (4), (2), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501272
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top