Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501272

Chromodomain Helicase DNA Binding Protein 4 (CHD4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mi-2b, Mi2-BETA, 9530019N15Rik, AA617397, BC005710, D6Ertd380e, Mi-2beta, mKIAA4075, Mi-2, b230399n07, CHD4, im:7143343, si:ch211-51m24.3, si:ch211-57k11.10, wu:fb44b12, wu:fd12d03, MGC145363
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501272
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHD4 antibody: synthetic peptide directed towards the N terminal of human CHD4
Sequence QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDY TPGKKKKKKL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against CHD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHD4
Background CHD4 is a probable transcription regulator.The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein.
Molecular Weight 218kDa
Gene ID 1108
NCBI Accession NP_001264, NM_001273
UniProt Q14839
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sillibourne, Delaval, Redick et al.: "Chromatin remodeling proteins interact with pericentrin to regulate centrosome integrity." in: Molecular biology of the cell, Vol. 18, Issue 9, pp. 3667-80, 2007 (PubMed).

Alternatives for antigen "Chromodomain Helicase DNA Binding Protein 4 (CHD4)", type "Antibodies"
Hosts (20), (7)
Reactivities (27), (6), (2)
Applications (18), (17), (10), (9), (6), (4), (1)
Epitopes (3), (1), (1), (1), (1), (1)
Beacon