SP110 Nuclear Body Protein (SP110) (Middle Region) antibody

Details for Product No. ABIN501509
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IFI41, IFI75, IPR1, VODI, 5031415C07Rik, 52kDa, 5830484A20Rik, ENSMUSG00000075603, Ifi75, Ipr1, SP110
Epitope
Middle Region
(11), (11), (5), (5), (3), (1)
Reactivity
Human
(49), (18), (16), (1)
Host
Rabbit
(37), (9), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(46), (24), (7), (7), (5), (5), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN501509
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SP110
Sequence DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFH EANDGGFWTL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SP110. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SP110
Background The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and is a leukocyte-specific nuclear body component. The protein can function as a
Molecular Weight 81 kDa
Gene ID 3431
NCBI Accession NM_080424, NP_536349
UniProt Q9HB58-6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 713 AA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SP110 Nuclear Body Protein (SP110) (Middle Region) antibody WB Suggested Anti-SP110 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
Background publications Cliffe, Wong, Taylor et al.: "The first prenatal diagnosis for veno-occlusive disease and immunodeficiency syndrome, an autosomal recessive condition associated with mutations in SP110." in: Prenatal diagnosis, Vol. 27, Issue 7, pp. 674-6, 2007 (PubMed).

Hosts (37), (9), (3)
Reactivities (49), (18), (16), (1)
Applications (46), (24), (7), (7), (5), (5), (3), (1)
Epitopes (11), (11), (5), (5), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top