Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501509

SP110 Nuclear Body Protein (SP110) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IFI41, IFI75, IPR1, VODI, 5031415C07Rik, 52kDa, 5830484A20Rik, ENSMUSG00000075603, Ifi75, Ipr1, SP110
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501509
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-SP110 Nuclear Body Protein (SP110) (Middle Region) antibody

Product details

Target Details Application Details Handling Images References Alternatives back to top
Immunogen The immunogen for anti-SP110 antibody: synthetic peptide directed towards the middle region of human SP110
Sequence DMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFH EANDGGFWTL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SP110. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified

Target Details

Application Details Handling Images References Alternatives back to top
Alternative Name SP110
Background The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and is a leukocyte-specific nuclear body component. The protein can function as a
Molecular Weight 81kDa
Gene ID 3431
NCBI Accession NP_536349, NM_080424
UniProt Q9HB58-6
Research Area Chromatin and Nuclear Signaling, Transcription Factors

Application Details

Target Details Handling Images References Alternatives back to top
Restrictions For Research Use only

Handling

Target Details Application Details Images References Alternatives back to top
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SP110 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C

References

Target Details Application Details Handling Images Alternatives back to top
Background publications Cliffe, Wong, Taylor et al.: "The first prenatal diagnosis for veno-occlusive disease and immunodeficiency syndrome, an autosomal recessive condition associated with mutations in SP110." in: Prenatal diagnosis, Vol. 27, Issue 7, pp. 674-6, 2007 (PubMed).

Alternatives

Target Details Application Details Handling Images References back to top
Alternatives for antigen "SP110 Nuclear Body Protein (SP110)", type "Antibodies"
Hosts (33), (9), (3)
Reactivities (45), (15), (14), (1)
Applications (42), (25), (7), (6), (5), (2), (1), (1), (1)
Epitopes (11), (11), (5), (5), (1), (1)
Beacon