Did you know that you can buy products from over 140 different suppliers from us?

CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A) (Middle Region) antibody

Details for Product No. ABIN501569
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHRNA7, CHRNA7-DR1, D-10
Epitope
Middle Region
(4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(16), (3), (3), (2), (2), (2), (1), (1)
Host
Rabbit
(15), (3), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(17), (4), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501569
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CHRFAM7A
Sequence DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKM PKWTRVILLN
Predicted Reactivity Bovine :100 %,   Human :100 %,   Rhesus macaque :100 %,   Chicken :100 %,   Egyptian mongoose :100 %,   Pig :100 %,   Rat :90 %,   Mouse :90 %,   Green puffer :80 %,   Japanese pufferfish :80 %,   Zebrafish :80 %,  
Characteristics This is a rabbit polyclonal antibody against CHRFAM7A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CHRFAM7A
Background The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsych
Molecular Weight 35 kDa
Gene ID 89832
NCBI Accession NM_148911, NP_683709
UniProt Q8IUZ4
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 321 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Martin, Leonard, Hall et al.: "Sensory gating and alpha-7 nicotinic receptor gene allelic variants in schizoaffective disorder, bipolar type." in: American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, Vol. 144B, Issue 5, pp. 611-4, 2007 (PubMed).

Hosts (15), (3), (1)
Reactivities (16), (3), (3), (2), (2), (2), (1), (1)
Applications (17), (4), (3), (1), (1)
Epitopes (4), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501569
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top