Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501569

CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHRNA7, CHRNA7-DR1, D-10
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501569
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHRFAM7A antibody: synthetic peptide directed towards the middle region of human CHRFAM7A
Sequence DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKM PKWTRVILLN
Predicted Reactivity Bovine :100%,   Human :100%,   Rhesus macaque :100%,   Chicken :100%,   Egyptian mongoose :100%,   Pig :100%,   Rat :92%,   Mouse :92%,   Green puffer :85%,   Japanese pufferfish :85%,   Zebrafish :84%,  
Characteristics This is a rabbit polyclonal antibody against CHRFAM7A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHRFAM7A
Background The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsych
Molecular Weight 35kDa
Gene ID 89832
NCBI Accession NP_683709, NM_148911
UniProt Q8IUZ4
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHRFAM7A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Martin, Leonard, Hall et al.: "Sensory gating and alpha-7 nicotinic receptor gene allelic variants in schizoaffective disorder, bipolar type." in: American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, Vol. 144B, Issue 5, pp. 611-4, 2007 (PubMed).

Alternatives for antigen "CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion (CHRFAM7A)", type "Antibodies"
Hosts (14), (4)
Reactivities (15), (2), (2), (2), (2), (2), (1), (1)
Applications (16), (7), (2), (1)
Epitopes (4), (2), (1)
Beacon