Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501657

Nuclear Factor (erythroid-Derived 2)-Like 1 (NFE2L1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LCR-F1, NRF1, TCF11
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501657
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NFE2L1 antibody: synthetic peptide directed towards the middle region of human NFE2L1
Sequence FGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQAR RQERKPKDRR
Predicted Reactivity Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against NFE2L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NFE2L1
Background NFE2L1 activates erythroid-specific, globin gene expression.This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
Molecular Weight 85kDa
Gene ID 4779
NCBI Accession NP_003195, NM_003204
UniProt Q14494
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NFE2L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wang, Kwok, Chan: "The p65 isoform of Nrf1 is a dominant negative inhibitor of ARE-mediated transcription." in: The Journal of biological chemistry, Vol. 282, Issue 34, pp. 24670-8, 2007 (PubMed).

Alternatives for antigen "Nuclear Factor (erythroid-Derived 2)-Like 1 (NFE2L1)", type "Antibodies"
Hosts (12), (2)
Reactivities (14), (6), (2)
Applications (14), (5)
Epitopes (6), (2), (2), (2), (1)
Beacon