Did you know that you can buy products from over 140 different suppliers from us?

Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 2 (SOHLH2) (Middle Region) antibody

Details for Product No. ABIN501798
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SPATA28, TEB1, bHLHe81, RGD1304752, 4933406N12Rik, AI413378
Epitope
Middle Region
(7), (7), (4), (1), (1), (1)
Reactivity
Human
(30), (12), (12)
Host
Rabbit
(28), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (11), (10), (4), (4), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501798
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SOHLH2
Sequence LNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSK LLPRYCTSGL
Predicted Reactivity Human : 100 %, Dog : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against SOHLH2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SOHLH2
Background SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis.
Molecular Weight 47 kDa
Gene ID 54937
NCBI Accession NM_017826, NP_060296
UniProt Q9NX45
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 425 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 2 (SOHLH2) (Middle Region) antibody WB Suggested Anti-SOHLH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501798
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top