Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501798

Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 2 (SOHLH2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SPATA28, TEB1, bHLHe81, RGD1304752, 4933406N12Rik, AI413378
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501798
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SOHLH2 antibody: synthetic peptide directed towards the middle region of human SOHLH2
Sequence LNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSK LLPRYCTSGL
Predicted Reactivity Human : 100%, Dog : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against SOHLH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SOHLH2
Background SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis.
Molecular Weight 47kDa
Gene ID 54937
NCBI Accession NP_060296, NM_017826
UniProt Q9NX45
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SOHLH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Spermatogenesis and Oogenesis Specific Basic Helix-Loop-Helix 2 (SOHLH2)", type "Antibodies"
Hosts (18), (2)
Reactivities (20), (12), (12)
Applications (10), (7), (5), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon