Did you know that you can buy products from over 140 different suppliers from us?

TRIO and F-Actin Binding Protein (TRIOBP) (Middle Region) antibody

Details for Product No. ABIN501880
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms tara, DFNB28, TARA, dJ37E16.4, AI428493, EST478828, Tara, mKIAA1662
Epitope
Middle Region
(2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(16), (4), (4), (1), (1), (1), (1)
Host
Rabbit
(11), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (6), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501880
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIOBP
Sequence VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVG VITVPVLQTR
Predicted Reactivity Bovine : 100 %, Human : 100 %, Dog : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Guinea pig : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIOBP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIOBP
Background TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel
Molecular Weight 47 kDa
Gene ID 11078
NCBI Accession NM_138632, NP_619538
UniProt Q9H2D6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 431 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TRIO and F-Actin Binding Protein (TRIOBP) (Middle Region) antibody WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate
Background publications Yu, Lan, Zhu et al.: "The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara." in: Biochemical and biophysical research communications, Vol. 367, Issue 4, pp. 805-12, 2008 (PubMed).

Validation Images
back to top