Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501880

TRIO and F-Actin Binding Protein (TRIOBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DFNB28, TARA, dJ37E16.4, AI428493, EST478828, Tara, mKIAA1662, tara
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501880
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP
Sequence VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVG VITVPVLQTR
Predicted Reactivity Bovine : 100%, Human : 100%, Dog : 92%, Horse : 92%, Mouse : 91%, Rat : 91%, Guinea pig : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against TRIOBP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIOBP
Background TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel
Molecular Weight 47kDa
Gene ID 11078
NCBI Accession NP_619538, NM_138632
UniProt Q9H2D6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIOBP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yu, Lan, Zhu et al.: "The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara." in: Biochemical and biophysical research communications, Vol. 367, Issue 4, pp. 805-12, 2008 (PubMed).

Alternatives for antigen "TRIO and F-Actin Binding Protein (TRIOBP)", type "Antibodies"
Hosts (9), (4)
Reactivities (13), (3), (3), (1), (1), (1), (1)
Applications (12), (4), (2), (2), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon