Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7) (Middle Region) antibody

Details for Product No. ABIN502170
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4
Epitope
Middle Region
(3), (2), (2), (1), (1), (1), (1)
Reactivity
Human
(11)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (3), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN502170
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CYP2A7
Sequence KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKN LMMSTLNLFI
Predicted Reactivity Human : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against CYP2A7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CYP2A7
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Molecular Weight 56 kDa
Gene ID 1549
NCBI Accession NM_172058, NP_000755
UniProt P20853
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 494 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7) (Middle Region) antibody WB Suggested Anti-CYP2A7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN cell lysate
Background publications Orten, Fischer, Sorensen et al.: "Branchio-oto-renal syndrome (BOR): novel mutations in the EYA1 gene, and a review of the mutational genetics of BOR." in: Human mutation, Vol. 29, Issue 4, pp. 537-44, 2008 (PubMed).

Hosts (12), (1)
Reactivities (11)
Applications (13), (3), (3), (2), (2), (2)
Epitopes (3), (2), (2), (1), (1), (1), (1)
back to top