Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502170

Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502170
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7
Sequence KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKN LMMSTLNLFI
Predicted Reactivity Human : 100%, Dog : 92%
Characteristics This is a rabbit polyclonal antibody against CYP2A7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CYP2A7
Background This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Molecular Weight 56kDa
Gene ID 1549
NCBI Accession NP_000755, NM_172058
UniProt P20853
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CYP2A7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Orten, Fischer, Sorensen et al.: "Branchio-oto-renal syndrome (BOR): novel mutations in the EYA1 gene, and a review of the mutational genetics of BOR." in: Human mutation, Vol. 29, Issue 4, pp. 537-44, 2008 (PubMed).

Alternatives for antigen "Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7)", type "Antibodies"
Hosts (12), (1)
Reactivities (11), (1), (1), (1), (1), (1)
Applications (13), (4), (4), (2), (2), (2)
Epitopes (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon