CYP2A7 antibody (N-Term)
-
- Target See all CYP2A7 Antibodies
- CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2A7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 A7 antibody was raised against the N terminal of CYP2 7
- Purification
- Affinity purified
- Immunogen
- CYP2 A7 antibody was raised using the N terminal of CYP2 7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN
- Top Product
- Discover our top product CYP2A7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2A7 Blocking Peptide, catalog no. 33R-6180, is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))
- Alternative Name
- CYP2A7 (CYP2A7 Products)
- Synonyms
- CPA7 antibody, CPAD antibody, CYP2A antibody, CYPIIA7 antibody, P450-IIA4 antibody, cytochrome P450 family 2 subfamily A member 7 antibody, CYP2A7 antibody
- Background
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum, its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
- Molecular Weight
- 56 kDa (MW of target protein)
-