Did you know that you can buy products from over 140 different suppliers from us?

Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody

Details for Product No. ABIN502325
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms si:dkey-24b15.1, zgc:158695, AI315068, AU040738, mKIAA0804, RGD1309443, KIAA0804
Epitope
N-Term
(2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(8), (3), (3)
Host
Rabbit
(6), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (5), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502325
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human VPS8
Sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDD PTLAICNDSG
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against VPS8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name VPS8
Background VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.
Molecular Weight 162 kDa
Gene ID 23355
NCBI Accession NM_001009921, NP_001009921
UniProt B9EIQ1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1428 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody WB Suggested Anti-VPS8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502325
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top