Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502325

Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms si:dkey-24b15.1, zgc:158695, AI315068, AU040738, mKIAA0804, RGD1309443, KIAA0804
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502325
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VPS8 antibody: synthetic peptide directed towards the N terminal of human VPS8
Sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDD PTLAICNDSG
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against VPS8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name VPS8
Background VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.
Molecular Weight 162kDa
Gene ID 23355
NCBI Accession NP_001009921, NM_001009921
UniProt B9EIQ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VPS8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 8 Homolog (S. Cerevisiae) (VPS8)", type "Antibodies"
Hosts (5), (3)
Reactivities (7), (3), (3), (1), (1), (1), (1), (1), (1)
Applications (8), (5), (3), (1)
Epitopes (2), (2)
Beacon