Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502371

Hect Domain and RLD 4 (HERC4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms mKIAA1593, 1700056O17Rik, 4921531D01Rik, 9530080M15Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502371
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4
Sequence LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQ AIDHNEGFSL
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Rabbit : 100%, Bovine : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against HERC4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HERC4
Background HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transf
Molecular Weight 118kDa
Gene ID 26091
NCBI Accession NP_071362, NM_022079
UniProt Q5GLZ8
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HERC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hochrainer, Mayer, Baranyi et al.: "The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects." in: Genomics, Vol. 85, Issue 2, pp. 153-64, 2005 (PubMed).

Alternatives for antigen "Hect Domain and RLD 4 (HERC4)", type "Antibodies"
Hosts (27), (3)
Reactivities (28), (17), (5), (2), (2), (2)
Applications (21), (11), (10), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2)
Beacon