Hect Domain and RLD 4 (HERC4) (Middle Region) antibody

Details for Product No. ABIN502371
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms mKIAA1593, 1700056O17Rik, 4921531D01Rik, 9530080M15Rik
Epitope
Middle Region
(3), (2), (2), (2), (2)
Reactivity
Human
(30), (18), (6), (2), (2), (2)
Host
Rabbit
(28), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (11), (10), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN502371
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HERC4
Sequence LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQ AIDHNEGFSL
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Bovine : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against HERC4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HERC4
Background HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transf
Molecular Weight 118 kDa
Gene ID 26091
NCBI Accession NM_022079, NP_071362
UniProt Q5GLZ8
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1057 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Hect Domain and RLD 4 (HERC4) (Middle Region) antibody WB Suggested Anti-HERC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate
Background publications Hochrainer, Mayer, Baranyi et al.: "The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects." in: Genomics, Vol. 85, Issue 2, pp. 153-64, 2005 (PubMed).

Hosts (28), (4)
Reactivities (30), (18), (6), (2), (2), (2)
Applications (23), (11), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2)
back to top