Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502534

Glycoprotein 2 (Zymogen Granule Membrane) (GP2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZAP75, 2310037I18Rik, AV060639, gp80
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502534
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GP2 antibody: synthetic peptide directed towards the middle region of human GP2
Sequence SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYE GDAVELSVES
Predicted Reactivity Human : 100%, Horse : 92%, Mouse : 91%, Rat : 83%, Bovine : 78%, Pig : 78%
Characteristics This is a rabbit polyclonal antibody against GP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GP2
Background GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Molecular Weight 43kDa
Gene ID 2813
NCBI Accession NP_001007242, NM_001007241
UniProt P55259
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tamiya, Shinya, Imanishi et al.: "Whole genome association study of rheumatoid arthritis using 27 039 microsatellites." in: Human molecular genetics, Vol. 14, Issue 16, pp. 2305-21, 2005 (PubMed).

Alternatives for antigen "Glycoprotein 2 (Zymogen Granule Membrane) (GP2)", type "Antibodies"
Hosts (6)
Reactivities (7)
Applications (4), (3), (3), (2), (1)
Epitopes (3), (2), (1), (1), (1)
Beacon