Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502786

Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERdj4, MDG-1, MDG1, MST049, MSTP049, AA408011, AA673251, AA673481, AW556981, Mdg1, mDj7
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502786
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9
Sequence MATPQSIFIFAICILMITELILASKSYYDILGVPKSASER QIKKAFHKLA
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, African clawed frog : 92%, Bovine : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against DNAJB9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DNAJB9
Background DNAJB9 acts as a co-chaperone with an Hsp70 protein.
Molecular Weight 25kDa
Gene ID 4189
NCBI Accession NP_036460, NM_012328
UniProt Q9UBS3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DNAJB9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9)", type "Antibodies"
Hosts (9), (9), (2)
Reactivities (14), (6), (3), (2), (1), (1), (1)
Applications (11), (8), (2), (2), (2)
Epitopes (4), (2), (2), (2), (2), (1), (1)
Beacon