Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27) (C-Term) antibody

Details for Product No. ABIN502931
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RABL4, RAYL, Rabl4, 2600013G09Rik
Epitope
C-Term
(3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(6)
Host
Rabbit
(5), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(7), (2)
Pubmed 1 reference available
Catalog no. ABIN502931
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RABL4
Sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREK VEVFRALA
Predicted Reactivity Human :100 %,   Sheep :80 %,   Bovine :80 %,   Rat :70 %,   Mouse :70 %,   Chicken :70 %,  
Characteristics This is a rabbit polyclonal antibody against RABL4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RABL4
Background RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown.
Molecular Weight 20 kDa
Gene ID 11020
NCBI Accession NM_006860, NP_006851
UniProt Q9BW83-2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 185 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27) (C-Term) antibody WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (5), (2)
Reactivities (6)
Applications (7), (2)
Epitopes (3), (2), (2), (1)
back to top