Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502931

Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RABL4, RAYL, Rabl4, 2600013G09Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502931
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4
Sequence RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREK VEVFRALA
Predicted Reactivity Human :100%,   Sheep :85%,   Bovine :85%,   Rat :78%,   Mouse :78%,   Chicken :76%,  
Characteristics This is a rabbit polyclonal antibody against RABL4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RABL4
Background RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown.
Molecular Weight 20kDa
Gene ID 11020
NCBI Accession NP_006851, NM_006860
UniProt Q9BW83-2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RABL4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27)", type "Antibodies"
Hosts (5), (2)
Reactivities (6)
Applications (7), (2), (1)
Epitopes (4), (2), (2), (1)
Beacon