RABL4 antibody (C-Term)

Catalog No. ABIN634436

Product Details anti-RABL4 Antibody

Target: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABL4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RABL4 antibody was raised against the C terminal of RABL4

Purification: Affinity purified

Immunogen: RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABL4 Blocking Peptide, catalog no. 33R-7831, is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABL4

Target: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Alternative Name: RABL4 (IFT27 Products)

Synonyms: 2600013G09Rik antibody, Rabl4 antibody, RABL4 antibody, RAYL antibody, intraflagellar transport 27 antibody, Ift27 antibody, IFT27 antibody

Background: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Hedgehog Signaling