Did you know that you can buy products from over 140 different suppliers from us?

NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) (Middle Region) antibody

Details for Product No. ABIN502997
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4932416N14Rik, nek11, MGC147549
Epitope
Middle Region
(8), (6), (4), (2), (1)
Reactivity
Rat (Rattus), Human
(33), (3), (2)
Host
Rabbit
(18), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(30), (21), (6), (6), (6), (3), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502997
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NEK11
Sequence KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTK TITTMAEDMS
Predicted Reactivity Horse : 100 %, Human : 100 %, Rat : 70 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against NEK11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NEK11
Background NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses (Noguchi et al., 2002 [PubMed 12154088]).
Molecular Weight 74 kDa
Gene ID 79858
NCBI Accession NM_024800, NP_079076
UniProt Q8NG66
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 645 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) (Middle Region) antibody WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502997
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top