Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502997

NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4932416N14Rik, nek11, MGC147549
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502997
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11
Sequence KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTK TITTMAEDMS
Predicted Reactivity Horse : 100%, Human : 100%, Rat : 78%, Bovine : 76%
Characteristics This is a rabbit polyclonal antibody against NEK11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NEK11
Background NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses (Noguchi et al., 2002 [PubMed 12154088]).
Molecular Weight 74kDa
Gene ID 79858
NCBI Accession NP_079076, NM_024800
UniProt Q8NG66
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NEK11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11)", type "Antibodies"
Hosts (10), (8), (1)
Reactivities (19), (4), (2)
Applications (17), (9), (6), (4), (2), (1), (1)
Epitopes (3), (2), (2), (1)
Beacon