Did you know that you can buy products from over 140 different suppliers from us?

beta 1,3-Galactosyltransferase-Like (B3GALTL) (Middle Region) antibody

Details for Product No. ABIN503023
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B3GTL, Gal-T, B3GLCT, B3Glc-T, beta3Glc-T, Gm1057
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(13), (2)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (9), (9), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503023
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human B3GALTL
Sequence DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKAR QETQKGFREE
Predicted Reactivity Dog : 92 %
Characteristics This is a rabbit polyclonal antibody against B3GALTL. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name B3GALTL
Background B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1, MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2, MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008 [PubMed 18199743]).
Molecular Weight 56 kDa
Gene ID 145173
NCBI Accession NM_194318, NP_919299
UniProt Q6Y288
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 498 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-beta 1,3-Galactosyltransferase-Like (B3GALTL) (Middle Region) antibody WB Suggested Anti-B3GALTL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: SH-SYSY cell lysate
Background publications Hess, Keusch, Oberstein et al.: "Peters Plus syndrome is a new congenital disorder of glycosylation and involves defective Omicron-glycosylation of thrombospondin type 1 repeats." in: The Journal of biological chemistry, Vol. 283, Issue 12, pp. 7354-60, 2008 (PubMed).

Hosts (13), (1)
Reactivities (13), (2)
Applications (14), (9), (9), (2), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503023
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top