Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503057

TP53 Apoptosis Effector (PERP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms THW, KCP1, PIGPC1, KRTCAP1, 1110017A08Rik, dJ496H19.1, RP3-496H19.1, PERP, PERPL, kcp1, krtcap1, pigpc1, thw, fk24g11, wu:fk24g11, LOC100221212
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503057
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP
Sequence FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVT YIYNWAYGFG
Predicted Reactivity Human : 100%, Horse : 92%, Bovine : 85%, Dog : 85%, Mouse : 85%, Pig : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against PERP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PERP
Background PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.
Molecular Weight 21kDa
Gene ID 64065
NCBI Accession NP_071404, NM_022121
UniProt Q96FX8
Research Area Signaling, Extracellular Matrix, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PERP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ihrie, Attardi: "Perp-etrating p53-dependent apoptosis." in: Cell cycle (Georgetown, Tex.), Vol. 3, Issue 3, pp. 267-9, 2004 (PubMed).

Alternatives for antigen "TP53 Apoptosis Effector (PERP)", type "Antibodies"
Hosts (44), (6)
Reactivities (47), (14), (13), (12), (11), (11)
Applications (39), (15), (10), (9), (9), (4), (4), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (17), (4), (2), (2), (1), (1), (1)
Beacon