Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503187

URI1, Prefoldin-Like Chaperone (URI1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C19orf2, NNX3, PPP1R19, RMP, URI, c19orf2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503187
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C19orf2 antibody: synthetic peptide directed towards the middle region of human C19orf2
Sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLR SISCEEATCS
Predicted Reactivity Rabbit : 100%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against C19orf2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C19orf2
Background The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Weight 55kDa
Gene ID 8725
NCBI Accession NP_604431, NM_134447
UniProt Q6NX55
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C19orf2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Djouder, Metzler, Schmidt et al.: "S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling." in: Molecular cell, Vol. 28, Issue 1, pp. 28-40, 2007 (PubMed).

Alternatives for antigen "URI1, Prefoldin-Like Chaperone (URI1)", type "Antibodies"
Hosts (8)
Reactivities (8)
Applications (4), (4), (3), (1)
Epitopes (2), (1), (1)
Beacon