Did you know that you can buy products from over 140 different suppliers from us?

URI1, Prefoldin-Like Chaperone (URI1) (Middle Region) antibody

Details for Product No. ABIN503187
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C19orf2, NNX3, PPP1R19, RMP, URI, c19orf2
Epitope
Middle Region
(10), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
(20)
Host
Rabbit
(20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (8), (5), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503187
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C19orf2
Sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLR SISCEEATCS
Predicted Reactivity Rabbit : 100 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against C19orf2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C19orf2
Background The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Molecular Weight 55 kDa
Gene ID 8725
NCBI Accession NM_134447, NP_604431
UniProt Q6NX55
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 495 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-URI1, Prefoldin-Like Chaperone (URI1) (Middle Region) antibody WB Suggested Anti-C19orf2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
Background publications Djouder, Metzler, Schmidt et al.: "S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling." in: Molecular cell, Vol. 28, Issue 1, pp. 28-40, 2007 (PubMed).

Hosts (20)
Reactivities (20)
Applications (15), (8), (5), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (10), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503187
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top