Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1) (C-Term) antibody

Details for Product No. ABIN503287
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIF2B, EIF2BA, eIF-2a, 26kDa, D5Ertd406e, DDBDRAFT_0219393, DDBDRAFT_0231375, DDB_0219393, DDB_0231375
Epitope
C-Term
(2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(10), (3), (2)
Host
Rabbit
(9), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (3), (3), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503287
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EIF2B1
Sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTP SAVSDELIKL
Predicted Reactivity Mouse : 85 %, Dog : 75 %, Pig : 75 %, Rabbit : 75 %
Characteristics This is a rabbit polyclonal antibody against EIF2B1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EIF2B1
Background EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Molecular Weight 34 kDa
Gene ID 1967
NCBI Accession NM_001414, NP_001405
UniProt Q14232
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 305 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1) (C-Term) antibody WB Suggested Anti-EIF2B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Maletkovic, Schiffmann, Gorospe et al.: "Genetic and clinical heterogeneity in eIF2B-related disorder." in: Journal of child neurology, Vol. 23, Issue 2, pp. 205-15, 2008 (PubMed).

Hosts (9), (2)
Reactivities (10), (3), (2)
Applications (11), (3), (3), (2), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top