Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503287

Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIF2B, EIF2BA, eIF-2a, 26kDa, D5Ertd406e, DDBDRAFT_0219393, DDBDRAFT_0231375, DDB_0219393, DDB_0231375
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503287
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1
Sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTP SAVSDELIKL
Predicted Reactivity Mouse : 85%, Dog : 78%, Pig : 78%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against EIF2B1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EIF2B1
Background EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Molecular Weight 34kDa
Gene ID 1967
NCBI Accession NP_001405, NM_001414
UniProt Q14232
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF2B1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Maletkovic, Schiffmann, Gorospe et al.: "Genetic and clinical heterogeneity in eIF2B-related disorder." in: Journal of child neurology, Vol. 23, Issue 2, pp. 205-15, 2008 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1)", type "Antibodies"
Hosts (11), (2)
Reactivities (12), (3), (2)
Applications (13), (4), (4), (3), (3), (2), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon