EIF2B1 antibody (C-Term)

Catalog No. ABIN632422

Product Details anti-EIF2B1 Antibody

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF2 B1 antibody was raised against the C terminal of EIF2 1

Purification: Affinity purified

Immunogen: EIF2 B1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2B1 Blocking Peptide, catalog no. 33R-1107, is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2B1

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Alternative Name: EIF2B1 (EIF2B1 Products)

Synonyms: DDBDRAFT_0219393 antibody, DDBDRAFT_0231375 antibody, DDB_0219393 antibody, DDB_0231375 antibody, 26kDa antibody, D5Ertd406e antibody, EIF2B antibody, EIF2BA antibody, eIF-2a antibody, translation initiation factor eIF-2B alpha subunit antibody, hypothetical protein antibody, Translation initiation factor eIF-2B subunit alpha antibody, eukaryotic translation initiation factor 2B subunit alpha antibody, eukaryotic translation initiation factor 2B, subunit 1 (alpha) antibody, eIF2b1 antibody, PGTG_05021 antibody, ei2ba antibody, eif2b1 antibody, Eif2b1 antibody, EIF2B1 antibody

Background: EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process