Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503292

Casein Kinase 1, delta (CSNK1D) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASPS, CKIdelta, FASPS2, HCKID, AA409348, 1200006A05Rik, D930010H05Rik, CKI-delta, CKId, ckIdelta, csnk1d, zgc:77627, wu:fb69b03, wu:fj97a05, CSNK1D
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503292
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D
Sequence NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASI NTHLGIEQSR
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against CSNK1D. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CSNK1D
Background This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is highly similar to the mouse and rat CK1 del
Molecular Weight 47kDa
Gene ID 1453
NCBI Accession NP_001884, NM_001893
UniProt P48730
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CSNK1D antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Meng, Logunova, Maywood et al.: "Setting clock speed in mammals: the CK1 epsilon tau mutation in mice accelerates circadian pacemakers by selectively destabilizing PERIOD proteins." in: Neuron, Vol. 58, Issue 1, pp. 78-88, 2008 (PubMed).

Alternatives for antigen "Casein Kinase 1, delta (CSNK1D)", type "Antibodies"
Hosts (29), (10), (5), (1)
Reactivities (41), (24), (21), (14), (11), (11), (11)
Applications (32), (25), (11), (9), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (2), (2), (2), (2), (1), (1)
Beacon