Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503337

Tribbles Homolog 1 (Drosophila) (TRIB1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C8FW, GIG2, TRB1, SKIP1, Gig2, Trb1, TRB-1, A530090O15Rik, c8fw, gig2, skip1, trb1, tribbles, TRIB1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503337
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1
Sequence TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEIL NTTGTYSGKA
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Dog : 92%
Characteristics This is a rabbit polyclonal antibody against TRIB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIB1
Background TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.
Molecular Weight 41kDa
Gene ID 10221
NCBI Accession NP_079471, NM_025195
UniProt Q96RU8
Research Area Stem Cells, Hematopoietic Progenitors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kathiresan, Melander, Guiducci et al.: "Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans." in: Nature genetics, Vol. 40, Issue 2, pp. 189-97, 2008 (PubMed).

Alternatives for antigen "Tribbles Homolog 1 (Drosophila) (TRIB1)", type "Antibodies"
Hosts (27), (10), (4)
Reactivities (35), (19), (17), (13), (12), (1)
Applications (24), (22), (10), (6)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (3), (2), (2), (1), (1), (1)
Beacon