Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503464

Leucine Rich Repeat Containing 50 (LRRC50) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930457P18Rik, Lrrc50, RGD1310542, CILD13, LRRC50, ODA7, LLRC50
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503464
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRRC50 antibody: synthetic peptide directed towards the N terminal of human LRRC50
Sequence LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENL EAQTELRCLF
Predicted Reactivity Dog : 92%
Characteristics This is a rabbit polyclonal antibody against LRRC50. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRRC50
Background LRRC50 contains 6 LRR (leucine-rich) repeats. It is proposed that LRRC50 to be a novel candidate gene for human cystic kidney disease, involved in regulation of microtubule-based cilia and actin-based brush border microvilli.
Molecular Weight 80kDa
Gene ID 123872
NCBI Accession NP_848547, NM_178452
UniProt Q8NEP3
Research Area Signaling, Cytoskeleton, Microfilaments
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRRC50 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Leucine Rich Repeat Containing 50 (LRRC50)", type "Antibodies"
Hosts (13), (5)
Reactivities (16), (4), (4), (3), (3), (1), (1), (1)
Applications (18), (3), (2), (1)
Epitopes (3)
Beacon