Did you know that you can buy products from over 140 different suppliers from us?

F-Box Protein 31 (FBXO31) (Middle Region) antibody

Details for Product No. ABIN503496
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110003O08Rik, 2310046N15Rik, Fbx14, Fbxo14, FBX14, FBXO14, Fbx31, pp2386, RGD1561069, fbx14, fbx31, fbxo14
Epitope
Middle Region
(8), (7), (3), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(33), (13), (13), (13), (12), (12), (2)
Host
Rabbit
(26), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (13), (10), (4), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503496
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FBXO31
Sequence VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGT GLIAGHGFTS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against FBXO31. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FBXO31
Background FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognizes phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest. FBXO31 may act as a tumor suppressor.Members of the F-box protein family, such as FBXO31, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
Molecular Weight 40 kDa
Gene ID 79791
NCBI Accession NM_024735, NP_079011
UniProt Q5XUX0
Research Area Cancer, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 367 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-F-Box Protein 31 (FBXO31) (Middle Region) antibody WB Suggested Anti-FBXO31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503496
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top