Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503596

Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TIH1, Tih1, zgc:92333, si:dz182n13.5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503596
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHLDA3 antibody: synthetic peptide directed towards the N terminal of human PHLDA3
Sequence LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVT EGGGEIDFRC
Predicted Reactivity Rat :100%,   Mouse :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against PHLDA3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PHLDA3
Background The exact function of PHLDA3 remains unknown.
Molecular Weight 14kDa
Gene ID 23612
NCBI Accession NP_036528, NM_012396
UniProt Q9Y5J5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHLDA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3)", type "Antibodies"
Hosts (8), (6)
Reactivities (12), (6), (5)
Applications (11), (4), (4), (1), (1)
Epitopes (2), (1), (1)
Beacon