Did you know that you can buy products from over 140 different suppliers from us?

Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3) (N-Term) antibody

Details for Product No. ABIN503596
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TIH1, Tih1, si:dz182n13.5, zgc:92333
Epitope
N-Term
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(14), (8), (7)
Host
Rabbit
(10), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (6), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503596
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PHLDA3
Sequence LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVT EGGGEIDFRC
Predicted Reactivity Rat :100 %,   Mouse :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against PHLDA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHLDA3
Background The exact function of PHLDA3 remains unknown.
Molecular Weight 14 kDa
Gene ID 23612
NCBI Accession NM_012396, NP_036528
UniProt Q9Y5J5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 127 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3) (N-Term) antibody WB Suggested Anti-PHLDA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 293T cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top