Did you know that you can buy products from over 140 different suppliers from us?

Glucosidase, Alpha, Neutral C (GANC) (Middle Region) antibody

Details for Product No. ABIN503774
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5830445O15Rik, 9330160A12, mFLJ00088
Epitope
Middle Region
(9), (8), (2), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Human
(13)
Host
Rabbit
(12), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (6), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503774
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GANC
Sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLS LNIATDWEVR
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Dog : 80 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against GANC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GANC
Background GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. This gene encodes a member of glycosyl hydrolases family 31. This enzyme hydrolyses terminal, non-reducing 1,4-linked alpha-D-glucose residues and releases alpha-D-glucose. This is a key enzyme in glycogen metabolism and its gene localizes to a chromosomal region (15q15) that is associated with susceptibility to diabetes.
Molecular Weight 104 kDa
Gene ID 2595
NCBI Accession NM_198141, NP_937784
UniProt Q8TET4
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 914 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glucosidase, Alpha, Neutral C (GANC) (Middle Region) antibody WB Suggested Anti-GANC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503774
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top