Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503774

Glucosidase, Alpha, Neutral C (GANC) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5830445O15Rik, 9330160A12, mFLJ00088
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503774
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GANC antibody: synthetic peptide directed towards the middle region of human GANC
Sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLS LNIATDWEVR
Predicted Reactivity Guinea pig : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Dog : 85%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against GANC. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GANC
Background GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. This gene encodes a member of glycosyl hydrolases family 31. This enzyme hydrolyses terminal, non-reducing 1,4-linked alpha-D-glucose residues and releases alpha-D-glucose. This is a key enzyme in glycogen metabolism and its gene localizes to a chromosomal region (15q15) that is associated with susceptibility to diabetes.
Molecular Weight 104kDa
Gene ID 2595
NCBI Accession NP_937784, NM_198141
UniProt Q8TET4
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GANC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Glucosidase, Alpha, Neutral C (GANC)", type "Antibodies"
Hosts (6), (2)
Reactivities (7)
Applications (8), (1)
Epitopes (3), (3), (2), (1), (1)
Beacon