Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503805

Dual serine/threonine and tyrosine Protein Kinase (DSTYK) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAKUT1, DustyPK, RIP5, RIPK5, Ripk5, C820013G01, A930019K20Rik, C430014H23Rik, ripk5, zgc:136421, DSTYK, GB11994, DUSTYPK, DDBDRAFT_0206258, DDBDRAFT_0232936, DDB_0206258, DDB_0232936
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503805
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RIPK5 antibody: synthetic peptide directed towards the middle region of human RIPK5
Sequence EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNS EQPNRGLDDS
Predicted Reactivity Rhesus macaque :100%,   Chimpanzee :100%,   Human :100%,   Bovine :85%,   Dog :85%,   Mouse :85%,   Chicken :78%,  
Characteristics This is a rabbit polyclonal antibody against RIPK5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RIPK5
Background RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Molecular Weight 100kDa
Gene ID 25778
NCBI Accession NP_955749, NM_199462
UniProt Q6XUX3-2
Research Area Signaling, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RIPK5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Dual serine/threonine and tyrosine Protein Kinase (DSTYK)", type "Antibodies"
Hosts (21), (5)
Reactivities (26), (13), (13), (11), (11)
Applications (15), (10), (9), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1)
Beacon