Did you know that you can buy products from over 140 different suppliers from us?

Dual serine/threonine and tyrosine Protein Kinase (DSTYK) (Middle Region) antibody

Details for Product No. ABIN503805
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ripk5, DSTYK, RIPK5, DDBDRAFT_0206258, DDBDRAFT_0232936, DDB_0206258, DDB_0232936, RIP5, CAKUT1, DustyPK, A930019K20Rik, C430014H23Rik, C820013G01, Ripk5, zgc:136421, DUSTYPK, GB11994
Epitope
Middle Region
(4), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Dog (Canine), Human, Chicken
(26), (13), (13), (11), (11)
Host
Rabbit
(21), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (9), (8), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RIPK5
Sequence EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNS EQPNRGLDDS
Predicted Reactivity Rhesus macaque :100 %,   Chimpanzee :100 %,   Human :100 %,   Bovine :80 %,   Dog :80 %,   Mouse :80 %,   Chicken :70 %,  
Characteristics This is a rabbit polyclonal antibody against RIPK5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RIPK5
Background RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.This gene encodes a dual serine/threonine and tyrosine protein kinase which is expressed in multiple tissues. Multiple alternatively spliced transcript variants have been found, but the biological validity of some variants has not been determined.
Molecular Weight 100 kDa
Gene ID 25778
NCBI Accession NM_199462, NP_955749
UniProt Q6XUX3-2
Research Area Signaling, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 884 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dual serine/threonine and tyrosine Protein Kinase (DSTYK) (Middle Region) antibody WB Suggested Anti-RIPK5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top