Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503856

Ribosomal Protein S3A (RPS3A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
FTE1, MFTL, S3A, Rps3a, RPS3AE, fb02h01, rpS3Ae, wu:fb02h01, zgc:73195, zgc:86672, C3, CG2168, Dmel\\CG2168, M(4)101, M(4)57g, M(4)[57g], M57g, M[57g], RPS3A, RPS3a, RpS3a, anon-EST:Liang-2.29, clone  ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503856
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPS3A antibody: synthetic peptide directed towards the N terminal of human RPS3A
Sequence APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADL QNDEVAFRKF
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against RPS3A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPS3A
Background RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 30kDa
Gene ID 6189
NCBI Accession NP_000997, NM_001006
UniProt P61247
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPS3A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Ribosomal Protein S3A (RPS3A)", type "Antibodies"
Hosts (13), (1)
Reactivities (12), (3), (3), (1), (1)
Applications (15), (5), (4), (3), (3), (3), (3)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon