Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal Protein S3A (RPS3A) (N-Term) antibody

Details for Product No. ABIN503856
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
FTE1, MFTL, S3A, Rps3a, RPS3AE, fb02h01, rpS3Ae, wu:fb02h01, zgc:73195, zgc:86672, C3, CG2168, Dmel\\CG2168, M(4)101, M(4)57g, M(4)[57g], M57g, M[57g], RPS3A, RPS3a, RpS3a, anon-EST:Liang-2.29, clone  ... show more
FTE1, MFTL, S3A, Rps3a, RPS3AE, fb02h01, rpS3Ae, wu:fb02h01, zgc:73195, zgc:86672, C3, CG2168, Dmel\\CG2168, M(4)101, M(4)57g, M(4)[57g], M57g, M[57g], RPS3A, RPS3a, RpS3a, anon-EST:Liang-2.29, clone 2.29, l(4)102ABa, fte-1, rps3a show less
Epitope
N-Term
(8), (7), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Pig (Porcine), Dog (Canine), Human
(19), (4), (3), (1), (1), (1)
Host
Rabbit
(20), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (11), (9), (9), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503856
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RPS3A
Sequence APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADL QNDEVAFRKF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against RPS3A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RPS3A
Background RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing alternative transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight 30 kDa
Gene ID 6189
NCBI Accession NM_001006, NP_000997
UniProt P61247
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 264 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal Protein S3A (RPS3A) (N-Term) antibody WB Suggested Anti-RPS3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver
anti-Ribosomal Protein S3A (RPS3A) (N-Term) antibody (2) Sample Type: Arabidopsis thaliana extract (30ug)
Primary Diltution: 1:1000
Secondary Antibody: anti-rabbit HRP
Secondary Dilution: 1:15,000
Exposure Time: 1 minute
Image Submitted By: Anonymous
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503856
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top