RPS3A antibody (N-Term)

Catalog No. ABIN631017

Product Details anti-RPS3A Antibody

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS3A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS3 A antibody was raised against the N terminal of RPS3

Purification: Affinity purified

Immunogen: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS3A Blocking Peptide, catalog no. 33R-1414, is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS3A

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Alternative Name: RPS3A (RPS3A Products)

Synonyms: FTE1 antibody, MFTL antibody, S3A antibody, Rps3a antibody, RPS3AE antibody, fb02h01 antibody, rpS3Ae antibody, wu:fb02h01 antibody, zgc:73195 antibody, zgc:86672 antibody, fte1 antibody, mftl antibody, rps3a antibody, C3 antibody, CG2168 antibody, Dmel\\CG2168 antibody, M(4)101 antibody, M(4)57g antibody, M(4)[57g] antibody, M57g antibody, M[57g] antibody, RPS3A antibody, RPS3a antibody, RpS3a antibody, anon-EST:Liang-2.29 antibody, clone 2.29 antibody, l(4)102ABa antibody, fte-1 antibody, ribosomal protein S3A antibody, ribosomal protein S3A1 antibody, ribosomal protein S3a antibody, ribosomal protein S3A L homeolog antibody, ribosomal protein S3A S homeolog antibody, Ribosomal protein S3A antibody, 40S ribosomal protein S3a antibody, 40S ribosomal protein S3A antibody, RPS3A antibody, Rps3a1 antibody, Rps3a antibody, rps3a antibody, rps3a.L antibody, rps3a.S antibody, RpS3A antibody, rs3a antibody, KRP-A antibody

Background: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 30 kDa (MW of target protein)