Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503906

Myotubularin Related Protein 12 (MTMR12) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3-PAP, PIP3AP, 3Pap, Pip3ap, mKIAA1682, 4932703C11, C730015A02Rik, MTMR12, pip3ap, im:7160376
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503906
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTMR12 antibody: synthetic peptide directed towards the middle region of human MTMR12
Sequence RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAK REDEFVDLGD
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 92%, Pig : 92%, Rabbit : 92%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against MTMR12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTMR12
Background MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes. The protein encoded by this gene functions as an adaptor subunit in a complex with an active PtdIns(3)P 3-phosphatase. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.
Molecular Weight 86kDa
Gene ID 54545
NCBI Accession NP_001035536, NM_001040446
UniProt Q9C0I1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTMR12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nandurkar, Layton, Laporte et al.: "Identification of myotubularin as the lipid phosphatase catalytic subunit associated with the 3-phosphatase adapter protein, 3-PAP." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 100, Issue 15, pp. 8660-5, 2003 (PubMed).

Alternatives for antigen "Myotubularin Related Protein 12 (MTMR12)", type "Antibodies"
Hosts (9), (2), (1)
Reactivities (10), (3), (3), (1)
Applications (11), (3), (1)
Epitopes (2), (1), (1)
Beacon