Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504075

Patatin-Like phospholipase Domain Containing 8 (PNPLA8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1200006O19Rik, AI467579, Ipla2(gamma), IPLA2(GAMMA), IPLA2-2, IPLA2G, iPLA2gamma, iPLA2, RGD1311444
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN504075
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PNPLA8 antibody: synthetic peptide directed towards the middle region of human PNPLA8
Sequence IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKG VAVKERIIPY
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Chicken : 91%, Zebrafish : 91%
Characteristics This is a rabbit polyclonal antibody against PNPLA8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PNPLA8
Background Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam
Molecular Weight 88kDa
Gene ID 50640
NCBI Accession NP_056538, NM_015599
UniProt Q9NP80
Research Area Cardiovascular, Fatty Acids, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PNPLA8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ali, Kokotos, Magrioti et al.: "Characterization of FKGK18 as inhibitor of group VIA Ca2+-independent phospholipase A2 (iPLA2β): candidate drug for preventing beta-cell apoptosis and diabetes." in: PLoS ONE, Vol. 8, Issue 8, pp. e71748, 2013 (PubMed).

Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Patatin-Like phospholipase Domain Containing 8 (PNPLA8)", type "Antibodies"
Hosts (13)
Reactivities (12), (5)
Applications (13), (8), (3), (2)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon