Did you know that you can buy products from over 140 different suppliers from us?

Adenylate Kinase 3 (AK3) (N-Term) antibody

Details for Product No. ABIN504111
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AK6, FIX, AK3L1, AKL3L, AKL3L1, AK-3, Ak3l, Ak3l1, Akl3l, AA407498, AI506714, AK3, CG6612, DAK3, Dak3, Dmel\\CG6612, bs12h03.y1, ak3l1, sb:cb845, zgc:64135, id:ibd3034, wu:fa02c11, wu:fc20h08, AK4, MG ... show more
AK6, FIX, AK3L1, AKL3L, AKL3L1, AK-3, Ak3l, Ak3l1, Akl3l, AA407498, AI506714, AK3, CG6612, DAK3, Dak3, Dmel\\CG6612, bs12h03.y1, ak3l1, sb:cb845, zgc:64135, id:ibd3034, wu:fa02c11, wu:fc20h08, AK4, MGC114646, wu:fc37g02, zgc:85790, AK3L2, ak4, NV16713, ak6 show less
Epitope
N-Term
(9), (7), (4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(56), (12), (5), (2), (2)
Host
Rabbit
(30), (28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(53), (30), (16), (9), (8), (5), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504111
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human AK3
Sequence MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGD LLRDNMLRGT
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 90 %, Dog : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against AK3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name AK3
Background The function of this protein remains unknown.
Molecular Weight 25 kDa
Gene ID 50808
NCBI Accession NM_016277, NP_057366
UniProt Q9UIJ7
Research Area Signaling, Metabolism, Amino Acids, Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 227 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Adenylate Kinase 3 (AK3) (N-Term) antibody WB Suggested Anti-AK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
Background publications Jenkins, Seelow, Jehee et al.: "RAB23 mutations in Carpenter syndrome imply an unexpected role for hedgehog signaling in cranial-suture development and obesity." in: American journal of human genetics, Vol. 80, Issue 6, pp. 1162-70, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504111
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top