Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504111

Adenylate Kinase 3 (AK3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AK6, FIX, AK3L1, AKL3L, AKL3L1, AK-3, Ak3l, Ak3l1, Akl3l, AA407498, AI506714, AK3, CG6612, DAK3, Dak3, Dmel\\CG6612, bs12h03.y1, ak3l1, sb:cb845, zgc:64135, id:ibd3034, wu:fa02c11, wu:fc20h08, AK4, MG ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504111
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AK3 antibody: synthetic peptide directed towards the N terminal of human AK3
Sequence MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGD LLRDNMLRGT
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, African clawed frog : 92%, Dog : 92%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against AK3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name AK3
Background The function of this protein remains unknown.
Molecular Weight 25kDa
Gene ID 50808
NCBI Accession NP_057366, NM_016277
UniProt Q9UIJ7
Research Area Signaling, Metabolism, Amino Acids, Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AK3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jenkins, Seelow, Jehee et al.: "RAB23 mutations in Carpenter syndrome imply an unexpected role for hedgehog signaling in cranial-suture development and obesity." in: American journal of human genetics, Vol. 80, Issue 6, pp. 1162-70, 2007 (PubMed).

Alternatives for antigen "Adenylate Kinase 3 (AK3)", type "Antibodies"
Hosts (23), (17)
Reactivities (40), (12), (4), (2), (2)
Applications (37), (20), (11), (8), (5), (5), (2), (1), (1)
Epitopes (4), (4), (3), (2), (2), (2), (1)
Beacon