Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504351

N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310081N20Rik, AC, Asah, ACDase, ASAH, PHP, PHP32, SMAPME, MGC82286, asah1, zgc:101637, ASAH1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504351
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the middle region of human ASAH1
Sequence QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKH PFFLDDRRTP
Predicted Reactivity Human : 100%, Horse : 92%, Mouse : 92%, Rat : 92%, Bovine : 84%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against ASAH1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ASAH1
Background This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into
Molecular Weight 14kDa
Gene ID 427
NCBI Accession NP_808592, NM_177924
UniProt Q13510
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ASAH1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Satta: "Population genetic analysis of the N-acylsphingosine amidohydrolase gene associated with mental activity in humans." in: Genetics, Vol. 178, Issue 3, pp. 1505-15, 2008 (PubMed).

Alternatives for antigen "N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1)", type "Antibodies"
Hosts (34), (7)
Reactivities (36), (22), (22), (13), (13), (12), (12), (2)
Applications (32), (20), (13), (10), (8), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (2), (2), (1), (1)
Beacon