Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182562

TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110030N06Rik, A530078N03Rik, Map3k7ip2, mKIAA0733, MAP3K7IP2, CHTD2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182562
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2
Sequence QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGE GDLNFSDDSG
Predicted Reactivity Mouse :100%,   Bovine :100%,   Dog :100%,   Rat :100%,   Human :100%,   Chicken :85%,  
Characteristics This is a rabbit polyclonal antibody against MAP3K7IP2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name MAP3K7IP2
Background MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
Molecular Weight 76kDa
Gene ID 23118
NCBI Accession NP_055908, NM_015093
UniProt Q9NYJ8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP3K7IP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kanayama, Seth, Sun et al.: "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains." in: Molecular cell, Vol. 15, Issue 4, pp. 535-48, 2004 (PubMed).

Alternatives for antigen "TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2)", type "Antibodies"
Hosts (16), (10), (6)
Reactivities (31), (5), (4), (3), (2)
Applications (17), (15), (10), (9), (6), (4), (2), (1), (1), (1)
Epitopes (9), (3), (3), (2), (1), (1)
Beacon