Did you know that you can buy products from over 140 different suppliers from us?

TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody

Details for Product No. ABIN182562
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHTD2, MAP3K7IP2, 1110030N06Rik, A530078N03Rik, Map3k7ip2, mKIAA0733, map3k7ip2, zgc:77446
Epitope
N-Term
(10), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(38), (6), (5), (2), (2)
Host
Rabbit
(20), (12), (6)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(20), (19), (11), (10), (7), (4), (4), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182562
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MAP3K7IP2
Sequence QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGE GDLNFSDDSG
Predicted Reactivity Mouse :100 %,   Bovine :100 %,   Dog :100 %,   Rat :100 %,   Human :100 %,   Chicken :80 %,  
Characteristics This is a rabbit polyclonal antibody against MAP3K7IP2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MAP3K7IP2
Background MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
Molecular Weight 76 kDa
Gene ID 23118
NCBI Accession NM_015093, NP_055908
UniProt Q9NYJ8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 693 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody (2) anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody (Image 2)
anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody (3) anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody (Image 3)
anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) (N-Term) antibody (4) WB Suggested Anti-MAP3K7IP2
Antibody Titration: 0.2-1 µg/mL
Positive Control: HepG2 cell lysate
TAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Background publications Kanayama, Seth, Sun et al.: "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains." in: Molecular cell, Vol. 15, Issue 4, pp. 535-48, 2004 (PubMed).

Validation Images
back to top